ABclonal
Recombinant Human Betacellulin/BTC Protein - RP01700
Recombinant Human Betacellulin/BTC Protein - RP01700
Couldn't load pickup availability
Recombinant Human Betacellulin/BTC Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01700-10, RP01700-20, RP01700-50, RP01700-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Betacellulin/BTC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp32-Tyr111) of human Betacellulin/BTC (Accession #NP_001720.1) fused with and a hFc tag at the C-terminus.
Alternate Names: BTC; Betacellulin
SWISS: P35070
GeneID: 685
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Betacellulin(BTC) is a member of the epidermal growth factor (EGF) family. These soluble proteins are ligands for one or more of the four receptor tyrosine kinases encoded by the ErbB gene family (ErbB-1/epidermal growth factor receptor (EGFR), neu/ErbB-2/HER2, ErbB-3/HER3 and ErbB-4/HER4). Betacellulin is a 32-kilodalton glycoprotein that appears to be processed from a larger transmembrane precursor by proteolytic cleavage. This protein is a ligand for the EGF receptor. BTC is a polymer of about 62-111 amino acid residues. Secondary Structure: 6% helical (1 helices; 3 residues)36% beta sheet (5 strands; 18 residues). BTC was originally identified as a growth-promoting factor in mouse pancreatic β-cell carcinoma cell line and has since been identified in humans. It plays a role in the growth and development of the neonate and/or mammary gland function. Betacellulin is a potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Bio-Activity: Measured in a cell proliferation assay using BALB/3T3 mouse fibroblasts. The ED50 for this effect is 1.02-4.06 ng/mL, corresponding to a specific activity of 2.46×10^5 ~9.80×10^5 units/mg.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
