Skip to product information
1 of 1

ABclonal

Recombinant Human BID Protein - RP00021

Recombinant Human BID Protein - RP00021

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human BID Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00021-10, RP00021-20, RP00021-50, RP00021-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human BID Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp195) of human BID (Accession #NP_001187.1) fused with a 6×His tag at the C-terminus.

Alternate Names: BID, FP497

SWISS: P55957

GeneID: 637

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The BH3 interacting domain death agonist (BID) is a pro-apoptotic member of the Bcl-2 protein family, which contains only the BH3 domain, and is required for its interaction with the Bcl-2 family proteins and for its pro-death activity. BID is important to cell death mediated by these proteases and thus is the sentinel to protease-mediated death signals. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human BID at 2 μg/mL (100 μL/well) can bind BCL-XL with a linear range of 0.195-4.94 ng/mL.

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.

Antigen Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details