Recombinant Human BID Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00021-10, RP00021-20, RP00021-50, RP00021-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human BID Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp195) of human BID (Accession #NP_001187.1) fused with a 6×His tag at the C-terminus.
Alternate Names: BID, FP497
SWISS: P55957
GeneID: 637
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The BH3 interacting domain death agonist (BID) is a pro-apoptotic member of the Bcl-2 protein family, which contains only the BH3 domain, and is required for its interaction with the Bcl-2 family proteins and for its pro-death activity. BID is important to cell death mediated by these proteases and thus is the sentinel to protease-mediated death signals. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human BID at 2 μg/mL (100 μL/well) can bind BCL-XL with a linear range of 0.195-4.94 ng/mL.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only