Skip to product information
1 of 1

Elabscience

Recombinant Human BMP-12 protein(N-His)(active) - PKSH034139

Recombinant Human BMP-12 protein(N-His)(active) - PKSH034139

Regular price $1,034.60 CAD
Regular price Sale price $1,034.60 CAD
Sale Sold out
Quantity

Get a quote

Recombinant Human BMP-12 protein(N-His)(active)

Size: 100μg

Catalogue Number: PKSH034139-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: BMP-12

Target Symptom: Growth/Differentiation Factor-7; GDF-7

Target Species: Human

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: Q7Z4P5

Accession: Q7Z4P5

Background: May play an active role in the motor area of the primate neocortex.

Activity: Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 112 ng/mL.

Sequence: MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAAAVPAAAVPRARAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADTITGFTDQATQDESAAETGQSFLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLLLLSTCPGAARAPRLLYSRAAEPLVGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPLPDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 47.78 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details