Skip to product information
1 of 1

ABclonal

Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein - RP00703

Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein - RP00703

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00703-10, RP00703-20, RP00703-50, RP00703-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Brain Natriuretic Peptide/NT-proBNP Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His27-Pro104) of human Brain Natriuretic Peptide/BNP (Accession #P16860) fused with a hFC tag at the C-terminus.

Alternate Names: NPPB, BNP

SWISS: P16860

GeneID: 4879

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly byventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNPprecursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriureticpeptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from theventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF)and atrial septal defect in patients without HF.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSP

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details