BioWorld
Recombinant Human Brain Natriuretic Peptide (rHuBNP) - PR1011
Recombinant Human Brain Natriuretic Peptide (rHuBNP) - PR1011
Couldn't load pickup availability
Recombinant Human Brain Natriuretic Peptide (rHuBNP)
Catalogue Numbers: PR1011-20, PR1011-100, PR1011-1000
Sizes: 20µg, 100µg, 1.0mg (Contact us for the 1.0mg option)
Source: Escherichia coli
Molecular Weight:3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids.
Purity: >97% by SDS-PAGE and HPLC analyses.
Biological Activity: Data Not Available.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.
AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Endotoxin: Less than 1EU/g of rHuCNTF as determined by LAL method.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.