ABclonal
Recombinant Human BST-1/CD157 Protein - RP00541
Recombinant Human BST-1/CD157 Protein - RP00541
Couldn't load pickup availability
Recombinant Human BST-1/CD157 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00541-20, RP00541-50, RP00541-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human BST-1/CD157 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly29-Lys292) of human CD157/BST1/ADP-ribosyl cyclase 2/Cyclic ADP-ribose hydrolase 2 (Accession #Q10588) fused with a 6×His tag at the C-terminus.
Alternate Names: BST1, CD157
SWISS: Q10588
GeneID: 683
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The cluster of differentiation (CD) system is a glycosyl phosphatidylinositol anchored membrane protein thatbelongs to the CD38 family.It is generally used in immunophynotyping. CD157 was discovered in a bonemarrow stromal cell line where it facilitates pre-B-cell growth. CD157 is a bifunctional ectoenzyme that exhibitsboth ADP-ribosyl cyclase and cyclic ADP ribose hydrolase activities followed with CD38. It plays a role inrheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Studieshave shown that this protein have a role in predicted to function as a cell surface receptor and animmunoregulatory molecule.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
