Recombinant Human BTN3A1/CD277 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01067-10, RP01067-20, RP01067-50, RP01067-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant human BTN3A1/CD277 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln30-Gly254) of human BTN3A1/CD277 (Accession #NP_919423.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: BTN3A1, BT3.1, BTF5, BTN3.1, CD277
SWISS: O00481-2
GeneID: 11119
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its ability to inhibit Anti-CD3-induced proliferation of jurkat. The ED50 for this effect is 24-96 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only