Skip to product information
1 of 1

ABclonal

Recombinant Human BTN3A3 Protein - RP02154

Recombinant Human BTN3A3 Protein - RP02154

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human BTN3A3 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02154-10, RP02154-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human BTN3A3 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln30-Trp248) of human BTN3A3 (Accession #O00478) fused with a 6xHis tag at the C- terminus.

Alternate Names: BTN3A3, BTF3, BTN3.3

SWISS: O00478

GeneID: 10384

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Human BTN3A3, also known as butyrophilin subfamily 3 member A3 and BTF3, is a Single-pass type I membrane protein which belongs to the immunoglobulin superfamily and BTN/MOG family. The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin domains and an intracellular B30.2 (PRYSPRY) domain. It can be detected in peripheral blood mononuclear cells, T-cells l, spleen and lymphocytes. BTN3A3 plays a role in T-cell responses in the adaptive immune response.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details