Skip to product information
1 of 1

ABclonal

Recombinant Human BY55/CD160 Protein - RP00566

Recombinant Human BY55/CD160 Protein - RP00566

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human BY55/CD160 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00566-10, RP00566-20, RP00566-50, RP00566-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD160 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ile27-Ser159) of human CD160 (Accession #O95971) fused with a 6×His tag at the C-terminus.

Alternate Names: CD160, BY55, NK1, NK28

SWISS: O95971

GeneID: 11126

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in thespleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cellsand CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for bothclassical and non-classical MHC class I molecules.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. Contact us for customized product form or formulation.

Antigen Sequence: INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details