Recombinant Human c-Kit ligand/KITLG/SCF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00124-10, RP00124-20, RP00124-50, RP00124-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human c-Kit ligand/KITLG/SCF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-His214) of human SCF/C-kit ligand (Accession #NP_000890.1) fused with a 6×His tag at the C-terminus.
Alternate Names: KITLG, DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SCF, SF, SHEP7
SWISS: P21583
GeneID: 4254
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is tyrosine-kinase receptor. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.
Bio-Activity: 1.Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 0.08-0.3 ng/mL.|2.Measured by its binding ability in a functional ELISA. Immobilized recombinant human SCF at 1 μg/mL (100 μL/well) can bind recombinant human CD117 with a linear range of 1-6 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only