Recombinant Human C1qR/CD93 Protein
Sizes: 10ug, 20ug
Catalogue Number: RP00164-10, RP00164-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human C1qR/CD93 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Lys580) of human CD93/C1QR1 (Accession #NP_036204.2) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4, CD93
SWISS: Q9NPY3
GeneID: 22918
Species: Human
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: C1q R1, also known as CD93 and C1q Rp, is an approximately 125 kDa cell-surface glycoprotein and type I membrane protei. The protein expressed on monocytes, neutrophils, endothelial cells, and stem cells.CD93 was originally identified as a myeloid cell-specific marker. but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only