Recombinant Human CADM3/IGSF4B Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02145-10, RP02145-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CADM3/IGSF4B Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Asn25-His330) of human CADM3 (Accession #Q8N126) fused with a 6xHis tag at the C- terminus.
Alternate Names: CADM3, BIgR, IGSF4B, NECL1, Necl-1, TSLL1, synCAM3
SWISS: Q8N126
GeneID: 57863
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Cell Adhesion Molecular Proteins are proteins located on the cell surface involved with the binding with other cells or with the extracellular matrix in the cell adhesion process. These proteins consists of three domains, an transmembrane domain, an intracellular domain that interacts with the cytoskeleton, and an extracellular domain that interacts with other CAMs of the same kind or with other CAMs or the extracellular matrix. Cell Adhesion Molecular 3 (CADM3) is a neural tissue-specific member of the nectin- like family of immunoglobulin superfamily. CADM3 interacts with EPB41L1 may regulate structure or function of cell-cell junctions. CADM3 has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, PVRL1 and PVRL3.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.Contact us for customized product form or formulation.
Antigen Sequence: NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only