Recombinant Human Carbonic anhydrase 5A/CA5A Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01791-10, RP01791-20, RP01791-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Carbonic anhydrase 5A/CA5A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala40-Ser305) of human CA5A (Accession #NP_001730.1) fused with 6×His tag at the C-terminus.
Alternate Names: CA5; CAV; CAVA; CA5AD; GS1-21A4.1; CA5A
SWISS: P35218
GeneID: 763
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Carbonic Anhydrase catalyzes the reversible reaction of CO2 + H2O = HCO3- + H+, which is fundamental to many processes such as respiration, renal tubular acidification and bone resorption (1). Topics in a CA meeting (6th International Conference on the CAs, June 20 - 25, 2003, Slovakia) ranged from the use of CAs as markers for tumor and hypoxia in the clinic, as a nutritional supplement in milk, and as a tool for CO2 removal and mosquito control in industry. Carbonic Anhydrase VA encoded by the CA5A gene is a mitochondrial protein (2, 3). In comparison with another mitochondrial CA (CA5B), CA5A has different tissue distribution and chromosomal location (4, 5). Expression and inhibitor studies of different CAs in the rat pancreatic beta cells indicate that CA5A may be involved in the regulation of insulin secretion (6). CA5A may also participate in the detoxification of ammonia produced in the gastrointestinal tract by providing bicarbonate to carbamyl phosphate synthetase I (7). The amino acid sequence of recombinant human CA5A (residues 40 to 305) is 79%, 77%, and 76% identical to that of canine, bovine, and rat/mouse.
Bio-Activity: Measured by its esterase activity. The specific activity is >600 pmol/min/µg, as measured under the described conditions.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 50mM NaAc,50mM NaCl,0.05% Brij-35, pH 5.0.
Antigen Sequence: AWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only