Skip to product information
1 of 1

ABclonal

Recombinant Human CCL1/I-309 Protein - RP01613

Recombinant Human CCL1/I-309 Protein - RP01613

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CCL1/I-309 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP01613-10, RP01613-20, RP01613-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL1/I-309 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Lys24-Lys96) of human CCL1/I-309 (Accession #NP_002972.1) fused with no additional amino acid.

Alternate Names: CCL1, I-309, P500, SCYA1, SISe, TCA3

SWISS: P22362

GeneID: 6346

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CCL1 or chemokine (C-C motif) ligand 1, also known as I-309 or TCA-3, is a member of the chemokine (C-C motif) ligand family. The C-C chemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands (CCL)-1 to 28. I-309/CCL1/TCA-3 interacts with the G protein-linked transmembrane chemokine receptors CCR8 and induces biochemical events that may result in the control of chemotaxis, proliferation, apoptosis and adhesion. It has been demonstrated that I-309/CCL1/TCA-3 displays chemotactic activity for monocytes and other cell types such as NK cells and dendritic cells, but not for neutrophils. Furthermore, as the only known physiological ligand for CCR8, I-309/CCL1/TCA-3 was identified as a potent inhibitor of HIV-1 envelope-mediated cell-cell fusion and virus infection. I-309/CCL1/TCA-3 induces significant levels of LTC4 from elicited eosinophils.

Source: Pichia

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details