WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CCL13/MCP-4 Protein - RP01614

Recombinant Human CCL13/MCP-4 Protein - RP01614

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human CCL13/MCP-4 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01614-10, RP01614-20, RP01614-50, RP01614-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL13/MCP-4 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln24-Thr98) of human CCL13/MCP-4 (Accession #NP_005399.1) fused with no additional amino acid.

Alternate Names: CCL13, CKb10, MCP-4, NCC-1, NCC1, SCYA13, SCYL1

SWISS: Q99616

GeneID: 6357

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Monocyte Chemoattractant Proteins 4 (MCP-4/CCL13) is a member of a distinct, structurally-related subclass of CC chemokines mainly involved in recruitment of eosinphils to inflammatory sites. CCL13/MCP-4, is a CC family chemokine that is chemoattractant for eosinophils, basophils, monocytes, macrophages, immature dendritic cells, and T cells, and its capable of inducing crucial immuno-modulatory responses through its effects on epithelial, muscular and endothelial cells. Similar to other CC chemokines, CCL13 binds to several chemokine receptors (CCR1, CCR2 and CCR3), allowing it to elicit different effects on its target cells. A number of studies have shown that CCL13 is involved in many chronic inflammatory diseases, in which it functions as a pivotal molecule involved in the selective recruitment of cell lineages to the inflamed tissues and their subsequent activation. MCP-4/CCL13 is secreted from chondrocytes and activates the proliferation of rheumatoid synovial cells, thereby leading to joint destruction in RA.

Source: Pichia

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only