Skip to product information
1 of 1

ABclonal

Recombinant Human CCL17/TARC Protein - RP01374

Recombinant Human CCL17/TARC Protein - RP01374

Regular price $280.00 CAD
Regular price Sale price $280.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CCL17/TARC Protein

Sizes: 50ug, 100ug

Catalogue Number: RP01374-50, RP01374-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL17/TARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser94) of human CCL17/TARC (Accession #NP_002978.1) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: CCL17, A-152E5.3, ABCD-2, SCYA17, TARC

SWISS: Q92583

GeneID: 6361

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokin ligand 17 (CCL17), also known as thymus and activation regulated chemokine(TARC), is a small cytokine belonging to the C-C chemokine family. CCL17 is expressed maily in thymus and transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL17 can induce chemotaxis in T cells by binding with the chemokine receptor CCR4.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details