ABclonal
Recombinant Human CCL17/TARC Protein - RP01374
Recombinant Human CCL17/TARC Protein - RP01374
Couldn't load pickup availability
Recombinant Human CCL17/TARC Protein
Sizes: 50ug, 100ug
Catalogue Number: RP01374-50, RP01374-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CCL17/TARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser94) of human CCL17/TARC (Accession #NP_002978.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: CCL17, A-152E5.3, ABCD-2, SCYA17, TARC
SWISS: Q92583
GeneID: 6361
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokin ligand 17 (CCL17), also known as thymus and activation regulated chemokine(TARC), is a small cytokine belonging to the C-C chemokine family. CCL17 is expressed maily in thymus and transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL17 can induce chemotaxis in T cells by binding with the chemokine receptor CCR4.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
