ABclonal
Recombinant Human CCL19/MIP-3 beta Protein - RP01832
Recombinant Human CCL19/MIP-3 beta Protein - RP01832
Couldn't load pickup availability
Recombinant Human CCL19/MIP-3 beta Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01832-10, RP01832-20, RP01832-50, RP01832-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CCL19/MIP-3 beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly22-Ser98) of human CCL19/MIP-3 beta (Accession #NP_006265.1) fused with a 6×His tag at the C-terminus.
Alternate Names: ELC; CKb11; MIP3B; MIP-3b; SCYA19; CCL19; MIP-3 beta
SWISS: Q99731
GeneID: 6363
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: C-C motif chemokine 19(CCL19) is as known as CK beta-11, ELC, MIP3B and SCYA19. May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
