Recombinant Human CCL24/Eotaxin-2 Protein - RP00318

Recombinant Human CCL24/Eotaxin-2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00318-10, RP00318-20, RP00318-50, RP00318-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL24/Eotaxin-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val27-Cys119) of human CCL24/Eotaxin-2 (Accession #O00175) fused with no additional amino acid.

Alternate Names: CCL24, Ckb-6, MPIF-2, MPIF2, SCYA24

SWISS: O00175

GeneID: 6369

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only