ABclonal
Recombinant Human CCL3/MIP-1 alpha Protein - RP01628
Recombinant Human CCL3/MIP-1 alpha Protein - RP01628
Couldn't load pickup availability
Recombinant Human CCL3/MIP-1 alpha Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01628-10, RP01628-20, RP01628-50, RP01628-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CCL3/MIP-1 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala23-Ala92) of human CCL3/MIP-1 alpha (Accession #NP_002974.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
SWISS: P10147
GeneID: 6348
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
