Skip to product information
1 of 1

ABclonal

Recombinant Human CCL3/MIP-1 alpha Protein - RP01628

Recombinant Human CCL3/MIP-1 alpha Protein - RP01628

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CCL3/MIP-1 alpha Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01628-10, RP01628-20, RP01628-50, RP01628-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL3/MIP-1 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala23-Ala92) of human CCL3/MIP-1 alpha (Accession #NP_002974.1) fused with and a 6×His tag at the C-terminus.

Alternate Names: CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3

SWISS: P10147

GeneID: 6348

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: This protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details