ABclonal
Recombinant Human CCL3/MIP-1 alpha Protein - RP01855
Recombinant Human CCL3/MIP-1 alpha Protein - RP01855
Couldn't load pickup availability
Recombinant Human CCL3/MIP-1 alpha Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01855-10, RP01855-20, RP01855-50, RP01855-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CCL3/MIP-1 alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala23-Ala92 ) of Human CCL3/MIP-1 alpha (Accession #NP_002974.1) fused with no tag.
Alternate Names: CCL3, G0S19-1, MIP1A, SCYA3, C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, Macrophage inflammatory protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible cytokine A3, Tonsillar lymphocyte LD78 alpha protein, Cleaved into: MIP-1-alpha(4-69), LD78-alpha(4-69)
SWISS: P10147
GeneID: 6348
Species: Human
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CCL3 also known as macrophage inflammatory protein 1-a, is a member of the CC subfamily. It’s known that CCL3 is produced by monocytes/macrophages, lymphocytes, neutrophils as well as immune cells such as basophils, mast cells, fibroblasts, and dendritic cells. Meanwhile, CCL3 exerts various biological effects by binding to its three cell surface receptors, including CCR1, CCR3, and CCR5. MIP-1a induces a variety of pro-inflammatory activities such as leukocyte chemotaxis, and promotes the entry of T cells into the inflammatory tissue region from blood circulation. Chemotactic CD4+ cells, CD8+ cells, natural killer cells, and dendritic cells bind to the corresponding receptors and coordinate the occurrence of immune reactions in the immune response site by migrating through vascular endothelial cells. In addition, MIP-1a is considered as a key inflammatory mediator in granuloma, asthma, T1D as well as other autoimmune diseases.
Source: E. coli
Tag: No-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
