WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CCL3L1 Protein - RP01834

Recombinant Human CCL3L1 Protein - RP01834

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human CCL3L1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01834-10, RP01834-20, RP01834-50, RP01834-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL3L1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala24-Ala93) of human CCL3L1 (Accession #NP_001001437.2) fused with a 6×His tag at the C-terminus.

Alternate Names: LD78; 464.2; MIP1AP; SCYA3L; G0S19-2; SCYA3L1; D17S1718; LD78BETA; LD78-beta(1-70)

SWISS: P16619

GeneID: 6349

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The two human MIP-1 alpha genes arise by duplication/mutation. They code for MIP-1 alpha isoforms CCL3/LD78 alpha and CCL3L1/LD78 beta, which share 94% amino acid (aa) sequence homology. Whereas the human CCL3/LD78 alpha is a single-copy gene, the human CCL3L1/LD78 beta gene copy number varies within the population. Human CCL3L1/LD78 beta cDNA encodes a 93 aa residue precursor with a 23 aa residue signal peptide that is cleaved to generate a 70 aa mature protein. Human CCL3L1/LD78 beta binds and signals through chemokine receptors CCR1 and CCR5. When compared to CCL3/LD78 alpha, CCL3L1/LD78 beta has higher binding affinity to CCR5, which also functions as a coreceptor for HIV-1 entry. The copy number of CCL3L1 is one of several genetic determinants of HIV-1 susceptibility (4).

Source: E. coli

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only