Skip to product information
1 of 1

ABclonal

Recombinant Human CCL5/RANTES Protein - RP01750LQ

Recombinant Human CCL5/RANTES Protein - RP01750LQ

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CCL5/RANTES Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01750LQ-10, RP01750LQ-20, RP01750LQ-50, RP01750LQ-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL5/RANTES Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser24-Ser91) of human CCL5/RANTES (Accession #NP_002976.2) fused with and a 6×His tag at the C-terminus.

Alternate Names: SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta

SWISS: P13501

GeneID: 6352

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.

Background: Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCL5 (Catalog: RP01750LQ) at 5 μg/mL (100 μL/well) can bind Mouse CXCL4 (Catalog: RP03170) with a linear range of 10-252.6 ng/mL.

Source: E. coli

Tag: C-6His

Formulation: Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.

Antigen Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details