Skip to product information
1 of 1

ABclonal

Recombinant Human CCL8/MCP-2 Protein - RP01947

Recombinant Human CCL8/MCP-2 Protein - RP01947

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CCL8/MCP-2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01947-10, RP01947-20, RP01947-50, RP01947-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CCL8/MCP-2 Protein by Pichia expression system. The target protein is expressed with sequence (Gln24-Pro99) of Human CCL8/MCP-2 (Accession #NP_005614.2) fused with No tag.

Alternate Names: CCL8, MCP2, SCYA10, SCYA8, C-C motif chemokine 8, HC14, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, MCP-2, Small-inducible cytokine A8, Cleaved into: MCP-2(6-76)

SWISS: P80075

GeneID: 6355

Species: Human

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2.Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes.

Source: Pichia

Tag: No-Tag

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details