Recombinant Human CD14 Protein - RP00990

Recombinant Human CD14 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00990-10, RP00990-20, RP00990-50, RP00990-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD14 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Cys352) of human CD14 (Accession #NP_000582.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD14

SWISS: P08571

GeneID: 929

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 5.7-23 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only