Recombinant Human CD14 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00990-10, RP00990-20, RP00990-50, RP00990-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CD14 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Cys352) of human CD14 (Accession #NP_000582.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CD14
SWISS: P08571
GeneID: 929
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 5.7-23 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only