Skip to product information
1 of 1

ABclonal

Recombinant Human CD177 Protein - RP01202

Recombinant Human CD177 Protein - RP01202

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CD177 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01202-10, RP01202-20, RP01202-50, RP01202-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD177 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly407) of human CD177 (Accession #NP_065139.2.) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: CD177, HNA-2a, HNA2A, NB1, NB1 GP, PRV-1, PRV1, NB1GP

SWISS: Q8N6Q3

GeneID: 57126

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human PDPN(Catalog: RP00208 ) at 5μg/mL (100 μL/well) can bind Human CD177(Catalog: RP01202) with a linear range of 6.8-250.6 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MSPVLLLALLGFILPLPGVQALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details