Skip to product information
1 of 1

ABclonal

Recombinant Human CD3 epsilon Protein - RP01178

Recombinant Human CD3 epsilon Protein - RP01178

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CD3 epsilon Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01178-10, RP01178-20, RP01178-50, RP01178-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD3 epsilon Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Asp126) of Human CD3 epsilon (Accession #NP_000724.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD3E, IMD18, T3E, TCRE, CD3e molecule

SWISS: P07766

GeneID: 916

Species: Human

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Anti-CD3 epsilon/CD3e Antibody at 1:3000 (100 μL/well) can bind recombinant Human CD3E, the EC50 of Human CD3E is 0.48 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details