ABclonal
Recombinant Human CD301 Protein - RP00207
Recombinant Human CD301 Protein - RP00207
Couldn't load pickup availability
Recombinant Human CD301 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00207-10, RP00207-20, RP00207-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CD301 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln61-His316) of human CLEC10A/MGL1/CD301 (Accession #NP_878910.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CLEC10A, CD301, CLECSF13, CLECSF14, HML, HML2, MGL
SWISS: Q8IUN9
GeneID: 10462
Species: Human
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CLEC10A, also known as macrophage galactose/N-acetyl-galactosamine (GalNAc) specific lectin (MGL), CD301, DC-ASGPR, and HML, is a 40 kDa type II transmembrane glycoprotein that belongs to the C-type lectin family. C-type lectin family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. CLEC10A is expressed on macrophages and related cells of myeloid origins, particularly immature dendritic cells (DCs). CLEC10A plays a protective role against colitis by effectively inducing IL-10 production by colonic lamina propria macrophages in response to invading commensal bacteria.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
