ABclonal
Recombinant Human CD34 Protein - RP01359
Recombinant Human CD34 Protein - RP01359
Couldn't load pickup availability
Recombinant Human CD34 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01359-10, RP01359-20, RP01359-50, RP01359-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CD34 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser32-Thr290) of human CD34 (Accession #NP_001020280.1) fused with a Fc, 6×His tag at the C-terminus.
Alternate Names: CD34, CD34 molecule, CD34 molecule, GIG3, MORT1
SWISS: P28906-1
GeneID: 947
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The CD34 protein is a member of a family of single-pass transmembrane sialomucin proteins that show expression on early hematopoietic and vascular-associated tissue. CD34 is also an important adhesion molecule and is required for T cells to enter lymph nodes. It is expressed on lymph node endothelia whereas the L-selectin to which it binds is on the T cell. It was indicated that CD34 is a phosphorylation target for activated PKC, and couples to the hematopoietic adapter protein CrkL, which were involved in CD34 signaling pathways. CD34 is abberantly expressed in many kinds of tumors and is implicated in leukemogenesis.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
