ABclonal
Recombinant Human CD47 Protein - RP00974
Recombinant Human CD47 Protein - RP00974
Couldn't load pickup availability
Recombinant Human CD47 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00974-10, RP00974-20, RP00974-50, RP00974-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CD47 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln19-Pro139) of human CD47 (Accession #NP_001768.1) fused with an Fc, 6×His tag at the C-terminus.
Alternate Names: CD47, IAP, MER6, OA3, CD47 molecule, IAP, MER6, OA3
SWISS: Q08722
GeneID: 961
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE; ≥95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD47 at 1 μg/mL (100 μL/well) can bind Recombinant Human SIRP alpha with a linear range of 1-6 ng/mL.
Source: HEK293 cells
Tag: C-hFc&His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
