Recombinant Human CD47 Protein
Sizes: 50ug, 100ug
Catalogue Number: RP01306-50, RP01306-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CD47 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Pro139) of human CD47 (Accession #NP_001768.1) fused with an 6×His tag at the C-terminus.
Alternate Names: CD47, IAP, MER6, OA3, CD47 molecule, IAP, MER6, OA3
SWISS: Q08722
GeneID: 961
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: This protein is a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 5 μg/mL (100 μL/well) can bind Human SIRPA with a linear range of 0.488-189.26 ng/mL.|Measured by its binding ability in a functional ELISA. Immobilized Human CD47 (Catalog: RP01306) at 2 μg/mL (100 μL/well) can bind Human SIRP-alpha/CD172a (Catalog: RP00171) with a linear range of 0.06-22.3 ng/mL.|3.Loaded Human SIRP-alpha/CD172a Protein, C-hFc&His(Catalog: RP00171) on ProA Biosensor, can bind Human CD47 Protein, C-His Tag (Catalog: RP01306) with an affinity constant of 11.1 nM as determined in BLI assay (Gator).
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only