Skip to product information
1 of 1

ABclonal

Recombinant Human CD63 Protein - RP01627

Recombinant Human CD63 Protein - RP01627

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CD63 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01627-10, RP01627-20, RP01627-50, RP01627-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD63 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala103-Val203) of human CD63 (Accession #NP_001771.1) fused with a 6×His tag at the C-terminus.

Alternate Names: MLA1; ME491; LAMP-3; OMA81H; TSPAN30, CD63

SWISS: P08962

GeneID: 967

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. Cluster of differentiation 63 (CD63) is a member of the CD family and the transmembrane 4 superfamily, also known as the tetraspanin family. CD63 is a cell surface glycoprotein characterized by the presence of four hydrophobic domains. CD63 had functions in mediating signal transduction processes and then regulate a variety of cellular processes such as cell proliferation, activation and motility. It has been reported that CD63 protein associated with tumor progression and served as a blood platelet activation marker and the deficiency of this protein may be associated with Hermansky-Pudlak syndrome.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details