Skip to product information
1 of 1

ABclonal

Recombinant Human CD7 Protein - RP01786

Recombinant Human CD7 Protein - RP01786

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CD7 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01786-10, RP01786-20, RP01786-50, RP01786-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Pro180) of human CD7 (Accession #NP_006128.1) fused with a 6×His tag at the C-terminus.

Alternate Names: GP40; TP41; Tp40; LEU-9; CD7

SWISS: P09564

GeneID: 924

Species: Human

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19+ B progenitor cells. Among CD8+ T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD7 Protein at 2μg/mL (100 μL/well) can bind human SECTM1(Catalog:RP00278) with a linear range of 0.098-1.3 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details