WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human CD7 Protein - RP02864

Recombinant Human CD7 Protein - RP02864

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Human CD7 Protein

Sizes: 10ug, 50ug

Catalogue Number: RP02864-10, RP02864-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Pro180) of human CD7 (Accession #NP_006128.1) fused with a hFc tag at the C-terminus.

Alternate Names: CD7 molecule; LEU-9; Tp40; TP41; GP40

SWISS: P09564

GeneID: 924

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains naive and memory cells, while more weak expressors are primarily effector cells.

Bio-Activity: Immobilized Human CD7, hFc Tag at 0.5μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Anti-CD7 Antibody, hFc Tag with the EC50 of 27.7ng/ml determined by ELISA.

Source: HEK293 cells

Tag: C-hFc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only