ABclonal
Recombinant Human CD83 Protein - RP00983
Recombinant Human CD83 Protein - RP00983
Couldn't load pickup availability
Recombinant Human CD83 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00983-10, RP00983-20, RP00983-50, RP00983-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CD83 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr20-Ala143) of human CD83 (Accession #NP_004224.1) fused with a 6×His tag at the C-terminus.
Alternate Names: BL11, HB15, CD83, HB15
SWISS: Q01151
GeneID: 9308
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Human CD83 is a 40 - 50 kDa member of the Siglec (or sialic-acid-binding immunoglobulin-like lectin) family of transmembrane proteins. CD83 is considered as a marker of mature dendritic cells as well as an adhesion receptor that binds to resting monocytes and a subset of activated CD8+ T cells. In certain conditions, CD83 tended to dimerize or even multimerize through its aberrant intermolecular disulfide bonds. The injection of CD83-Ig can significantly enhaunce the rate of tumor growth and inhibit the T cell growth.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
