Skip to product information
1 of 1

ABclonal

Recombinant Human CD8a Protein - RP01522

Recombinant Human CD8a Protein - RP01522

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CD8a Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01522-10, RP01522-20, RP01522-50, RP01522-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD8a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of human CD8a (Accession #NP_001139345.1) fused with a raFc tag at the C-terminus.

Alternate Names: CD8, Leu2, MAL, p32, CD8A, Leu2, MAL, p32

SWISS: P01732

GeneID: 925

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: T-cell surface glycoprotein CD8 alpha chain, also known as CD8a, is a single-pass type I membrane protein. The CD8 glycoprotein is expressed by thymocytes, mature T cells and natural killer (NK) cells and has been implicated in the recognition of monomorphic determinants on major histocompatibility complex (MHC) Class I antigens, and in signal transduction during the course of T-cell activation. Both human and rodent CD8 antigens are comprised of two distinct polypeptide chains, alpha and beta. The Ig domains of CD8 alpha are involved in controlling the ability of CD8 to be expressed. Mutation of B- and F-strand cysteine residues in CD8 alpha reduced the ability of the protein to fold properly and, therefore, to be expressed. Defects in CD8A are a cause of familial CD8 deficiency. Familial CD8 deficiency is a novel autosomal recessive immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections.

Source: HEK293 cells

Tag: C-Rabbit Fc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details