Skip to product information
1 of 1

ABclonal

Recombinant Human CD9 Protein - RP01652

Recombinant Human CD9 Protein - RP01652

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CD9 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01652-10, RP01652-20, RP01652-50, RP01652-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CD9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser112-Ile195) of human CD9 (Accession #NP_001760.1) fused with and a hFc tag at the C-terminus.

Alternate Names: MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29; CD9

SWISS: P21926

GeneID: 928

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD9 is a member of the transmembrane 4 superfamily, which is also known as the tetraspanin family. CD9 is a cell surface glycoprotein with 4 hydrophobic domains that are described as complex with integrins and other transmembrane 4 superfamily members. It is found expressed on the surface of the exosomes. The protein takes part in cellular signal transduction events and thus play a role in the regulation of cell development and activation, growth and motility. Besides, CD9 seems to be a key role in the egg-sperm fusion during the mammalian fertilization processes. CD9 is found on the membrane of the oocytes and also appears to intervene in maintaining the normal shape of oocyte microvilli.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details