Skip to product information
1 of 1

ABclonal

Recombinant Human CEACAM6/CD66c Protein - RP00982

Recombinant Human CEACAM6/CD66c Protein - RP00982

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CEACAM6/CD66c Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP00982-10, RP00982-20, RP00982-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CEACAM6/CD66c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly320) of human CEACAM6 (Accession #NP_002474.3) fused with a 6×His tag at the C-terminus.

Alternate Names: CEACAM6, NCA, Cell adhesion molecule CEACAM6, Carcinoembryonic antigen-related cell adhesion molecule 6, CEA cell adhesion molecule 6, Non-specific crossreacting antigen, Normal cross-reacting antigen, CD66c

SWISS: P40199

GeneID: 4680

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CEACAM6 at 2 μg/mL (100μL/well) can bind Recombinant Human CEACAM8 with a linear range of 0.1-0.4 μg/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details