ABclonal
Recombinant Human CEACAM6/CD66c Protein - RP00982
Recombinant Human CEACAM6/CD66c Protein - RP00982
Couldn't load pickup availability
Recombinant Human CEACAM6/CD66c Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00982-10, RP00982-20, RP00982-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CEACAM6/CD66c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly320) of human CEACAM6 (Accession #NP_002474.3) fused with a 6×His tag at the C-terminus.
Alternate Names: CEACAM6, NCA, Cell adhesion molecule CEACAM6, Carcinoembryonic antigen-related cell adhesion molecule 6, CEA cell adhesion molecule 6, Non-specific crossreacting antigen, Normal cross-reacting antigen, CD66c
SWISS: P40199
GeneID: 4680
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CEACAM6 at 2 μg/mL (100μL/well) can bind Recombinant Human CEACAM8 with a linear range of 0.1-0.4 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
