ABclonal
Recombinant Human CEACAM8/CD66b Protein - RP02155
Recombinant Human CEACAM8/CD66b Protein - RP02155
Couldn't load pickup availability
Recombinant Human CEACAM8/CD66b Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02155-10, RP02155-20, RP02155-50, RP02155-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CEACAM8/CD66b Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln35-Ser319) of human CEACAM8 (Accession #P31997) fused with a hFC tag at the C- terminus.
Alternate Names: CEACAM8, CD66b, CD67, CGM6, NCA-95
SWISS: P31997
GeneID: 1088
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) is a single chain, GPI-anchored, highly glycosylated protein which belongs to the immunoglobulin superfamily and the carcinoembryonic antigen(CEA) family. CEACAM8 is expressed by neutrophils and eosinophils, and serves as a binding partner for CEACAM-6 and Galectin-3. It contains two Ig-like C2-type (immunoglobulin-like) domains and one Ig-like V-type (immunoglobulin-like) domain. Mature human CEACAM8 is a 287 amino acid GPI-linked glycoprotein. CEACAM family members are a set of widely expressed proteins involved in several biological functions, including cell adhesion, migration, signal transduction, and the regulation of gene expression. Abnormal overexpression and downregulation of some CEACAMs have been described in tumor cells.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
