Skip to product information
1 of 1

ABclonal

Recombinant Human Cell surface A33 antigen/GPA33 Protein - RP00163

Recombinant Human Cell surface A33 antigen/GPA33 Protein - RP00163

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human Cell surface A33 antigen/GPA33 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00163-10, RP00163-20, RP00163-50, RP00163-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Cell surface A33 antigen/GPA33 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Val235) of human GPA33/Glycoprotein-A33 (Accession #NP_005805.1) fused with a 6×His tag at the C-terminus.

Alternate Names: A33, GPA33

SWISS: Q99795

GeneID: 10223

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Cell surface A33 antigen, also known as glycoprotein A33, is a single-pass type I membrane protein which is expressed in normal gastrointestinal epithelium and in 95% of colon cancers. GPA33 contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. Intracellular traffic and recycling to the cell surface appear to play a major role in GPA33 function and to have an influence on its surface density superseding translational regulation.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details