ABclonal
Recombinant Human Cerebral dopamine neurotrophic factor/CDNF Protein - RP01747
Recombinant Human Cerebral dopamine neurotrophic factor/CDNF Protein - RP01747
Couldn't load pickup availability
Recombinant Human Cerebral dopamine neurotrophic factor/CDNF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01747-10, RP01747-20, RP01747-50, RP01747-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Cerebral dopamine neurotrophic factor/ CDNF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln27-Leu187) of human Cerebral dopamine neurotrophic factor/ CDNF (Accession #NP_001025125.2) fused with and a 6×His tag at the C-terminus.
Alternate Names: ARMETL1; Cerebral dopamine neurotrophic factor; CDNF
SWISS: Q49AH0
GeneID: 441549
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Cerebral Dopamine Neurotrophic Factor (CDNF), also known as ARMETL1 (ARMET-like protein 1), is a secreted protein with eight conserved cysteine residues, predicting a unique protein fold and defining a new, evolutionarily conserved protein family. CDNF is a novel neurotrophic factor with strong trophic activity on dopaminergic neurons comparable to that of glial cell line-derived neurotrophic factor (GDNF). CDNF/ARMETL1 is a evolutionary conserved protein which can protect and restore the function of dopaminergic neurons in the rat model of Parkinson's disease, suggesting that CDNF might be beneficial for the treatment of Parkinson's disease. CDNF is widely expressed in neurons in several brain regions including cerebral cortex, hippocampus, substantia nigra, striatum and cerebellum. Human CDNF is glycosylated and secreted from transiently transfected cells. CDNF promotes the survival, growth, and function of dopamine-specific neurons and is expressed in brain regions that undergo cocaine-induced neuroplasticity.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
