ABclonal
Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein - RP02873
Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein - RP02873
Couldn't load pickup availability
Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein
Sizes: 10ug, 50ug
Catalogue Number: RP02873-10, RP02873-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Gln165) of Human Choriogonadotropin subunit beta 3/CGB3 (Accession #NP_000728.1) fused with 6×His tag at the C-terminus.
Alternate Names: CGB3, CGB, CGB5, CGB7, CGB8, hCGB
SWISS: P0DN86
GeneID: 1082
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Antigen Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
