WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Chorionic somatomammotropin hormone 1/Choriomammotropin/CSH1 Protein - RP01746

Recombinant Human Chorionic somatomammotropin hormone 1/Choriomammotropin/CSH1 Protein - RP01746

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Human Chorionic somatomammotropin hormone 1/Choriomammotropin/CSH1 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01746-10, RP01746-20, RP01746-50, RP01746-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Chorionic somatomammotropin hormone 1/Choriomammotropin/CSH1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val27-Phe217) of human Chorionic somatomammotropin hormone 1/Choriomammotropin/CSH1 (Accession #NP_001308.1) fused with a 6×His tag at the C-terminus.

Alternate Names: PL; CSA; CS-1; CSMT; GHB3; hCS-1; hCS-A

SWISS: P0DML2

GeneID: 1442

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Chorionic somatomammotropin hormone, also known as Choriomammotropin, Lactogen, Placental lactogen and CSH1, is a secreted protein which belongs to thesomatotropin / prolactin family. CSH1 is produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization. The CSH1 gene is member of the GH gene cluster on 17q, which consists of two growth hormone genes and three CSH genes. Genomic alterations in the GH cluster are well known, causing different phenotypes depending on the size of the deletion and the genes involved. The increased prevalence of hemizygosity of CSH1 in population in comparison to controls indicates a role for CSH1 haploinsufficiency in the etiology of growth retardation. Investigation of CSH1 deletions in further SRS and growth retarded patients will enable us to establish under which circumstances haploinsufficiency of CSH1 is likely to result in clinical changes.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only