Skip to product information
1 of 1

ABclonal

Recombinant Human CMRF35-like molecule 5/CD300LD Protein - RP01979

Recombinant Human CMRF35-like molecule 5/CD300LD Protein - RP01979

Regular price $420.00 CAD
Regular price Sale price $420.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CMRF35-like molecule 5/CD300LD Protein Sizes: 50ug, 100ug Catalogue Number: RP01979-50, RP01979-100 Citations, Manuals and MSDS Available upon request. Description: Recombinant Human CMRF35-like molecule 5/CD300LD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala19-His165) of Human CMRF35-like molecule 5/CD300LD (Accession #NP_001108624.1) fused with hFC at the C-terminus. Alternate Names: CD300LD, CD300D, CMRF35A4, UNQ9218/PRO28686, CMRF35-like molecule 5, CLM-5, CD300 antigen-like family member D, CMRF35-A4, CD300d SWISS: Q6UXZ3 GeneID: 100131439 Species: Human Purity: ≥ 95 % as determined by SDS-PAGE. Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week. Background: CD300d (also known as CD300LD or CMRF35A4) is a member of the CD300 family of transmembrane glycoproteins belonging to the immunoregulatory signaling (IRS) family. CD300d, like most CD300 family members, is found exclusively on myeloid cells, including monocyte and granulocytes. CD300 members contain a V-type immunoglobulin-like domain with an additional pair of cysteine residues in the extracellular domain (ECD), a transmembrane region, and a short cytoplasmic tail. The mature ECD of human CD300d is 146 amino acids (aa) and shares a 48% and 45% identity with mouse and rat CD300d, respectively. CD300d recruits ITAM-bearing Adaptor FceRg. CD300d interacts with all CD300 family members with exception of CD300c, and plays a role in the regulation and/or formation of CD300 complexes on the cell surface and consequently modulate the state of activation of myeloid cells. CD300 family members modulate a broad and diverse array of immune cell processes via their paired activating and inhibitory receptor functions. Mouse CD300d, along with CD300lf, has been identified as a receptor for permissive murine noroviral infection (MNoV). Further, expression of murine CD300LF on human and other mammalian cell lines confers crossspecies permissively. Additional research into CD300 family member function during viral infections could help develop novel anti-viral therapies. Source: HEK293 cells Tag: C-hFC Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Antigen Sequence: AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH Endotoxin: < 0.1 EU/μg of the protein by LAL method. Research Use Only
View full details