ABclonal
Recombinant Human CNTF Protein - RP00039
Recombinant Human CNTF Protein - RP00039
Couldn't load pickup availability
Recombinant Human CNTF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00039-10, RP00039-20, RP00039-50, RP00039-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CNTF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met200) of human CNTF (Accession #NP_000605.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CNTF, HCNTF
SWISS: P26441
GeneID: 1270
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this protein, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease.
Bio-Activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cell line. The ED50 for this effect is 13.5-54 ng/mL.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Antigen Sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
