ABclonal
Recombinant Human Coagulation factor III/Tissue factor/CD142 Protein - RP00112
Recombinant Human Coagulation factor III/Tissue factor/CD142 Protein - RP00112
Couldn't load pickup availability
Recombinant Human Coagulation factor III/Tissue factor/CD142 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP00112-20, RP00112-50, RP00112-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Coagulation factor III/Tissue factor/CD142 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly34-Glu251) of human Coagulation Factor III/Tissue Factor/CD142 (Accession #NP_001984.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CD142, TF, TFA, F3, TF, TFA
SWISS: P13726
GeneID: 2152
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The protein is coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human CD142 at 1 μg/mL (100 μL/well) can bind Human Tissue Factor Rabbit mAb with a linear range of 0.98-61.71 ng/mL.|2.Measured by its ability to activate Coagulation Factor VII in cleaving a fluorogenic peptide substrate Boc-VPR-AMC. The AC50 is <24.0 μg/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
