Recombinant Human Collagen I alpha 2/COL1A2 Protein - RP01630

Recombinant Human Collagen I alpha 2/COL1A2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01630-10, RP01630-20, RP01630-50, RP01630-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Collagen I alpha 2/COL1A2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp1120-Lys1366) of human Collagen I alpha 2/COL1A2 (Accession #NP_000080.2) fused with and a hFc tag at the C-terminus.

Alternate Names: COL1A2, OI4

SWISS: P08123

GeneID: 1278

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: DQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only