ABclonal
Recombinant Human Collagen I alpha 2/COL1A2 Protein - RP01630
Recombinant Human Collagen I alpha 2/COL1A2 Protein - RP01630
Couldn't load pickup availability
Recombinant Human Collagen I alpha 2/COL1A2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01630-10, RP01630-20, RP01630-50, RP01630-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human Collagen I alpha 2/COL1A2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp1120-Lys1366) of human Collagen I alpha 2/COL1A2 (Accession #NP_000080.2) fused with and a hFc tag at the C-terminus.
Alternate Names: COL1A2, OI4
SWISS: P08123
GeneID: 1278
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
