WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Cripto-1/TDGF1 Protein - RP00202

Recombinant Human Cripto-1/TDGF1 Protein - RP00202

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Human Cripto-1/TDGF1 Protein

Sizes: 10ug, 20ug, 50ug

Catalogue Numbers: RP00202-10, RP00202-20, RP00202-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human Cripto-1/TDGF1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu31-Thr172) of human Cripto/TDGF1 (Accession #NP_003203) fused with a 6×His tag at the C-terminus.

Alternate Names: TDGF1, CR, CRGF, CRIPTO

SWISS: P13385

GeneID: 6997

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Cripto/TDGF1 is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. TDGF1 is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. It is overexpressed in many types of cancers and acts as a growth factor for tumors. Cripto mutants display defects in mesoderm induction and heart morphogenesis, similar to phenotypes seen in Nodal mutants. Cripto can also activate mitogen-activated protein kinase (MAPK) and Akt pathways independently of Nodal by directly binding to a membrane-associated heparan sulfate proteoglycan, glypican-1.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Cripto at 2 μg/mL (100 μL/well) can bind Recombinant Human ALK4 with a linear range of 0.15-151 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only