ABclonal
Recombinant Human CRTAM/CD355 (A65V) Protein - RP02670
Recombinant Human CRTAM/CD355 (A65V) Protein - RP02670
Couldn't load pickup availability
Recombinant Human CRTAM/CD355 (A65V) Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02670-10, RP02670-20, RP02670-50, RP02670-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human PSMA/FOLH1 Protein is expressed from Expi293 with hFc tag at the N-terminal. It contains Lys44-Ala750.
Alternate Names: CD355 antigen; CD355; CRTAM
SWISS: O95727-1
GeneID: 56253
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Class-I Restricted T Cell-Associated Molecule (CRTAM) is a protein that is expressed after T cell activation. The interaction of CRTAM with its ligand, nectin-like 2 (Necl2), is required for the efficient production of IL-17, IL-22, and IFNγ by murine CD4 T cells, and it plays a role in optimal CD8 T and NK cell cytotoxicity. CRTAM promotes the pro-inflammatory cytokine profile; therefore, it may take part in the immunopathology of autoimmune diseases such as diabetes type 1 or colitis.
Source: HEK293 cells
Tag: C-His
Antigen Sequence: LTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPVLKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
