Skip to product information
1 of 1

ABclonal

Recombinant Human CSF-1/M-CSF Protein - RP01221

Recombinant Human CSF-1/M-CSF Protein - RP01221

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human CSF-1/M-CSF Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01221-10, RP01221-20, RP01221-50, RP01221-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human CSF-1/M-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu33-Arg255) of human M-CSF/CSF-1 (Accession #NP_000748.3) fused with a 6×His tag at the C-terminus.

Alternate Names: CSF1, CSF-1, MCSF

SWISS: P09603-1

GeneID: 1435

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Human CSF1 at 1μg/mL (100 μL/well) can bind Human CSF1R with a linear range of 0.01-7.8 ng/mL.|2.Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is typically 1.53-6.14 ng/mL, corresponding to a specific activity of 1.63×10^5 -6.53×10^5 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details