ABclonal
Recombinant Human CTHRC1 Protein - RP02799
Recombinant Human CTHRC1 Protein - RP02799
Couldn't load pickup availability
Recombinant Human CTHRC1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02799-10, RP02799-20, RP02799-50, RP02799-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CTHRC1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser31-Lys243) of human CTHRC1 (Accession #NP_612464.1) fused with a His tag at the C-terminus.
Alternate Names: CTHRC1; UNQ762/PRO1550; CTHRC1
SWISS: Q96CG8
GeneID: 115908
Species: Human
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Collagen triple helix repeat-containing protein 1, also known as Protein NMTC1, and CTHRC1, is a secreted protein that is glycosylated and highly conserved from lower chordates to mammals. CTHRC1 expression was not detectable in normal arteries. However, it is transiently expressed in the arterial wall in response to injury where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration. A short collagen motif with 12 Gly-X-Y repeats appears to be responsible for trimerization of the CTHRC1 protein and this renders the molecule susceptible to cleavage by collagenase. CTHRC1 overexpression caused a dramatic reduction in collagen type I mRNA and protein levels. Currently available data indicate that Cthrc1 expression in vascular cells regulates transforming growth factor beta responsiveness, thereby impacting transforming growth factor beta target genes, including collagens. Additionally, CTHRC1 increases bone mass as a positive regulator of osteoblastic bone formation and offers an anabolic approach for the treatment of osteoporosis.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
